TA343597 UBID4 / DPF2 antibody

Rabbit Polyclonal Anti-DPF2 Antibody

See related secondary antibodies

Search for all "UBID4 / DPF2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UBID4 / DPF2

Product Description for UBID4 / DPF2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UBID4 / DPF2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBID4 / DPF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Apoptosis response zinc finger protein, BAF45D, BRG1-associated factor 45D, D4 zinc and double PHD fingers family 2, REQ, Requiem, Zinc finger protein ubi-d4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92785
Immunogen:
The immunogen for anti-DPF2 antibody: synthetic peptide directed towards the middle region of human DPF2. Synthetic peptide located within the following region: QLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNS.
GeneID:
5977
Application WB
Background DPF2 is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UBID4 / DPF2 (5 products)

Catalog No. Species Pres. Purity   Source  

UBID4 / DPF2

UBID4 / DPF2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UBID4 / DPF2

UBID4 / DPF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBID4 / DPF2

UBID4 / DPF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBID4 / DPF2

UBID4 / DPF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBID4 / DPF2

UBID4 / DPF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UBID4 / DPF2 (2 products)

Catalog No. Species Pres. Purity   Source  

DPF2 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

DPF2 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-DPF2 antibody (H00005977-M01) by Western Blots.
  Abnova Taiwan Corp.

DPF2 Lysate

Western Blot: DPF2 Lysate [NBL1-09989] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DPF2
  Novus Biologicals Inc.
  • LinkedIn