TA343636 LZTR1 antibody

Rabbit Polyclonal Anti-LZTR1 Antibody

See related secondary antibodies

Search for all "LZTR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LZTR1

Product Description for LZTR1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LZTR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LZTR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Leucine-zipper-like transcriptional regulator 1, TCFL2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N653
Immunogen:
The immunogen for anti-LZTR1 antibody: synthetic peptide directed towards the N terminal of human LZTR1. Synthetic peptide located within the following region: AGPGSTGGQIGAAALAGGARSKVAPSVDFDHSCSDSVEYLTLNFGPFETV.
GeneID:
8216
Application WB
Background Leucine-zipper-like transcriptiol regulator 1(LZTR1) is belived to be a D-binding protein and transcriptiol regulator based on its predicted structural characteristics. The transcript is present in several essential fetal organs and is hemizygously deleted in some DiGeorge syndrome patients. LZTR1 is thought to play a critical role in embryogenesis.This gene encodes a member of the BTB-kelch superfamily. Initially described as a putative transcriptiol regulator based on weak homology to members of the basic leucine zipper-like family, the encoded protein subsequently has been shown to localize exclusively to the Golgi network where it may help stabilize the Gogli complex. Deletion of this gene may be associated with DiGeorge syndrome.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LZTR1 (2 products)

Catalog No. Species Pres. Purity   Source  

LZTR1

LZTR1 Human Purified
  Abnova Taiwan Corp.

LZTR1

LZTR1 Human Purified
  Abnova Taiwan Corp.

Positive controls for LZTR1 (1 products)

Catalog No. Species Pres. Purity   Source  

LZTR1 overexpression lysate

LZTR1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn