TA343638 ZBTB33 antibody

Rabbit Polyclonal Anti-ZBTB33 Antibody

See related secondary antibodies

Search for all "ZBTB33"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZBTB33

Product Description for ZBTB33

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZBTB33.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZBTB33

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KAISO, Transcriptional regulator Kaiso, ZNF348, Zinc finger and BTB domain-containing protein 33
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86T24
Immunogen:
The immunogen for anti-ZBTB33 antibody: synthetic peptide directed towards the N terminal of human ZBTB33. Synthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL.
GeneID:
10009
Application WB
Background ZBTB33 is a transcriptiol regulator with bimodal D-binding specificity. ZBTB33 binds to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3' and also binds to the non-methylated consensus sequence 5'-CTGC-3'. ZBTB33 recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt sigling pathway. It may also activate transcription of a subset of target genes by the recruitment of CTNND2.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZBTB33 (4 products)

Catalog No. Species Pres. Purity   Source  

ZBTB33

ZBTB33 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZBTB33

ZBTB33 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZBTB33

ZBTB33 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZBTB33

ZBTB33 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZBTB33 (2 products)

Catalog No. Species Pres. Purity   Source  

ZBTB33 293T Cell Transient Overexpression Lysate(Denatured)

ZBTB33 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZBTB33 overexpression lysate

ZBTB33 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn