TA343640 ZFP36L2 antibody

Rabbit Polyclonal Anti-ZFP36L2 Antibody

See related secondary antibodies

Search for all "ZFP36L2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZFP36L2

Product Description for ZFP36L2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZFP36L2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFP36L2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BRF2, Butyrate response factor 2, EGF-response factor 2, ERF-2, ERF2, RNF162C, TIS11D, Zinc finger protein 36 C3H1 type-like 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P47974
Immunogen:
The immunogen for anti-ZFP36L2 antibody: synthetic peptide directed towards the N terminal of human ZFP36L2. Synthetic peptide located within the following region: MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP.
GeneID:
678
Application WB
Background ZFP36L2 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFP36L2 (6 products)

Catalog No. Species Pres. Purity   Source  

ZFP36L2

ZFP36L2 Human
  Abnova Taiwan Corp.

ZFP36L2

ZFP36L2 Human Purified
  Abnova Taiwan Corp.

ZFP36L2

ZFP36L2 Human Purified
  Abnova Taiwan Corp.

ZFP36L2

ZFP36L2 Human in vitro transl.
  Abnova Taiwan Corp.

ZFP36L2

ZFP36L2 Human in vitro transl.
  Abnova Taiwan Corp.

ZFP36L2

ZFP36L2 Human in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn