TA343642 HOXC9 / HOX3B antibody

Rabbit Polyclonal Anti-Hoxc9 Antibody

See related secondary antibodies

Search for all "HOXC9 / HOX3B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HOXC9 / HOX3B

Product Description for HOXC9 / HOX3B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HOXC9 / HOX3B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXC9 / HOX3B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-C9, Hox-3B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09633
Immunogen:
The immunogen for Anti-Hoxc9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hoxc9. Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ.
GeneID:
15427
Application WB
Background Hoxc9 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positiol identities on the anterior-posterior axis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn