TA343645 SOX15 antibody

Rabbit Polyclonal Anti-SOX15 Antibody

See related secondary antibodies

Search for all "SOX15"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Porcine, Rabbit SOX15

Product Description for SOX15

Rabbit anti Equine, Guinea Pig, Human, Porcine, Rabbit SOX15.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SOX15

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SOX-12, SOX-15, SOX-20, SOX12, SOX20, SOX26, SOX27, SRY-box 15
Presentation Purified
Reactivity Eq, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60248
Immunogen:
The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the N terminal of human SOX15. Synthetic peptide located within the following region: MALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVK.
GeneID:
6665
Application WB
Background SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determition of the cell fate. The protein may act as a transcriptiol regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determition of the cell fate. The encoded protein may act as a transcriptiol regulator after forming a protein complex with other proteins.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SOX15 (2 products)

Catalog No. Species Pres. Purity   Source  

SOX15

SOX15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SOX15

SOX15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SOX15 (1 products)

Catalog No. Species Pres. Purity   Source  

SOX15 overexpression lysate

SOX15 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn