TA343649 ZNF17 antibody

Rabbit Polyclonal Anti-ZNF17 Antibody

See related secondary antibodies

Search for all "ZNF17"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat ZNF17

Product Description for ZNF17

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat ZNF17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HPF3, KIAA1947, KOX10, Zinc finger protein 17, Zinc finger protein KOX10
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17021
Immunogen:
The immunogen for anti-ZNF17 antibody: synthetic peptide directed towards the N terminal of human ZNF17. Synthetic peptide located within the following region: TEDYMVFEDVAIHFSQEEWGILNDVQRHLHSDVMLENFALLSSVGCWHGA.
GeneID:
7565
Application WB
Background ZNF17 is a new candidate transcription factor.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn