TA343652 ZNF197 antibody

Rabbit Polyclonal Anti-ZNF197 Antibody

See related secondary antibodies

Search for all "ZNF197"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat ZNF197

TA343652

More Views

  • TA343652

Product Description for ZNF197

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat ZNF197.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF197

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZKSCAN9, ZNF166, Zinc finger protein 197, Zinc finger protein with KRAB and SCAN domains 9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14709
Immunogen:
The immunogen for anti-ZNF197 antibody: synthetic peptide directed towards the N terminal of human ZNF197. Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY.
GeneID:
10168
Application WB
IHC
Background ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas.This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two altertively spliced transcripts encoding different isoforms have been described.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF197 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF197

ZNF197 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF197

ZNF197 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF197 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF197 overexpression lysate

ZNF197 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn