TA343654 MYST2 antibody

Rabbit Polyclonal Anti-MYST2 Antibody

See related secondary antibodies

Search for all "MYST2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MYST2

Product Description for MYST2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MYST2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYST2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HBO1, HBOa, Histone acetyltransferase MYST2, Histone acetyltransferase binding to ORC1, MOZ, SAS2, TIP60 protein 2, YBF2/SAS3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95251
Immunogen:
The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: PRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQ.
GeneID:
11143
Application WB
Background MYST2 belongs to the MYST family, which is characterized by a highly conserved C2HC zinc finger and a putative histone acetyltransferase domain. MYST2 specifically represses AR-mediated transcription. MYST2 is a new AR-interacting protein capable of modulating AR activity. It could play a significant role in regulating AR-dependent genes in normal and prostate cancer cells. The biochemical and genetic interactions of MYST family protein MYST2 with two components of the replication apparatus, MCM2 and ORC1, suggest that MYST2-associated HAT activity may play a direct role in the process of D replication. MYST2 is a positive regulatory factor for prereplicative complex assembly.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MYST2 (7 products)

Catalog No. Species Pres. Purity   Source  

MYST2

MYST2 Human
  Abnova Taiwan Corp.

MYST2

MYST2 Human Purified
  Abnova Taiwan Corp.

MYST2

MYST2 Human Purified
  Abnova Taiwan Corp.

MYST2

MYST2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MYST2

MYST2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MYST2

MYST2 Human
  Abnova Taiwan Corp.

MYST2

MYST2 Human
  Abnova Taiwan Corp.

Positive controls for MYST2 (2 products)

Catalog No. Species Pres. Purity   Source  

MYST2 293T Cell Transient Overexpression Lysate(Denatured)

MYST2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MYST2 Lysate

Western Blot: HBO1  Lysate [NBL1-13448] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MYST2
  Novus Biologicals Inc.
  • LinkedIn