TA343668 POU6F2 antibody

Rabbit Polyclonal Anti-POU6F2 Antibody

See related secondary antibodies

Search for all "POU6F2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat POU6F2

Product Description for POU6F2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat POU6F2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POU6F2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms POU domain class 6 transcription factor 2, RPF-1, RPF1, Retina-derived POU domain factor 1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78424
Immunogen:
The immunogen for anti-POU6F2 antibody: synthetic peptide directed towards the N terminal of human POU6F2. Synthetic peptide located within the following region: AATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQ.
GeneID:
11281
Application WB
Background POU6F2 is a member of a gene family characterized by the presence of a bipartite D-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptiol regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways.POU6F2 is a member of a gene family characterized by the presence of a bipartite D-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptiol regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-60 AC011292.3 84260-84319 61-553 U91935.1 102-594 554-927 AC005483.1 150160-150533 c 928-1068 AC005483.1 83435-83575 c 1069-1275 AC005483.1 56892-57098 c 1276-1613 U91935.1 1320-1657 1614-2223 AC005483.1 25384-25993 c
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POU6F2 (4 products)

Catalog No. Species Pres. Purity   Source  

POU6F2

POU6F2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POU6F2 (transcript variant 2)

POU6F2 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POU6F2

POU6F2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POU6F2

POU6F2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for POU6F2 (2 products)

Catalog No. Species Pres. Purity   Source  

POU6F2 overexpression lysate

POU6F2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

POU6F2 overexpression lysate

POU6F2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn