TA343683 AATF antibody

Rabbit Polyclonal Anti-AATF Antibody

See related secondary antibodies

Search for all "AATF"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat AATF

Product Description for AATF

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat AATF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AATF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Apoptosis-antagonizing transcription factor, CHE-1, CHE1, DED, HSPC277, Rb-binding protein Che-1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NY61
Immunogen:
The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF.
GeneID:
26574
Application WB
Background The AATF is a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kise known to be involved in the induction of cell apoptosis. AATF contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 D binding domain. Overexpression of AATF interfered with MAP3K12 induced apoptosis.The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kise known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 D binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AATF (6 products)

Catalog No. Species Pres. Purity   Source  

AATF (full length, C-term DDK tag)

AATF Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €411.00
  OriGene Technologies, Inc.

AATF

AATF Human
  Abnova Taiwan Corp.

AATF

AATF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AATF

AATF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AATF

AATF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AATF

AATF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AATF (1 products)

Catalog No. Species Pres. Purity   Source  

AATF Lysate

Western Blot: AATF Lysate [NBL1-07168] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AATF Protein
  Novus Biologicals Inc.
  • LinkedIn