TA343686 FOXB1 / FKH5 antibody

Rabbit Polyclonal Anti-FOXB1 Antibody

See related secondary antibodies

Search for all "FOXB1 / FKH5"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish FOXB1 / FKH5

Product Description for FOXB1 / FKH5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish FOXB1 / FKH5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXB1 / FKH5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Forkhead box protein B1, Transcription factor FKH-5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99853
Immunogen:
The immunogen for anti-FOXB1 antibody: synthetic peptide directed towards the N terminal of human FOXB1. Synthetic peptide located within the following region: MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYY.
GeneID:
27023
Application WB
Background FOXB1 is a winged helix/forkhead transcription factor. FOXB1 is specifically expressed in the developing central nervous system (CNS). Early embryonic FOXB1 expression is restricted to the mammiliary body region of the caudal hypothalamus, midbrain, hindbrain and spil cord. FOXB1 may play a role in posttal growth, lactation and CNS development.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXB1 / FKH5 (1 products)

Catalog No. Species Pres. Purity   Source  

FOXB1 / FKH5

FOXB1 / FKH5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FOXB1 / FKH5 (1 products)

Catalog No. Species Pres. Purity   Source  

FOXB1 overexpression lysate

FOXB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn