TA343695 KEAP1 antibody

Rabbit Polyclonal Anti-KEAP1 Antibody

See related secondary antibodies

Search for all "KEAP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KEAP1

TA343695

More Views

  • TA343695

Product Description for KEAP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KEAP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KEAP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytosolic inhibitor of Nrf2, INRF2, INrf2, KEAP1, KIAA0132, KLHL19, Kelch-like ECH-associated protein 1, Kelch-like protein 19
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14145
Immunogen:
The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC.
GeneID:
9817
Application WB
IHC
Background KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two altertively spliced transcript variants encoding the same isoform have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KEAP1 (4 products)

Catalog No. Species Pres. Purity   Source  

KEAP1 (transcript variant 1)

KEAP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KEAP1 (transcript variant 2)

KEAP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KEAP1

KEAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KEAP1

KEAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KEAP1 (2 products)

Catalog No. Species Pres. Purity   Source  

KEAP1 Lysate

Western Blot: KEAP1 Lysate [NBL1-12225] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KEAP1
  Novus Biologicals Inc.

KEAP1 Lysate

Western Blot: KEAP1 Lysate [NBL1-12226] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KEAP1
  Novus Biologicals Inc.
  • LinkedIn