TA343699 NFATC2 antibody

Rabbit Polyclonal Anti-NFATC2 Antibody

See related secondary antibodies

Search for all "NFATC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NFATC2

TA343699

More Views

  • TA343699

Product Description for NFATC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NFATC2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NFATC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NFAT pre-existing subunit, NFAT-1, NFATC2, NFATP, Nuclear factor of activated T-cells, T-cell transcription factor NFAT1, cytoplasmic 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13469
Immunogen:
The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE.
GeneID:
4773
Application WB
IHC
Background This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a D-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alterte transcriptiol splice variants, encoding different isoforms, have been characterized.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NFATC2 (6 products)

Catalog No. Species Pres. Purity   Source  

NFATC2 (transcript variant 2)

NFATC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

NFATC2 (transcript variant 1)

NFATC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NFATC2 (transcript variant D)

NFATC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NFATC2

NFATC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFATC2

NFATC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFATC2

NFATC2 Human
  Abnova Taiwan Corp.

Positive controls for NFATC2 (2 products)

Catalog No. Species Pres. Purity   Source  

NFATC2 overexpression lysate

NFATC2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

NFATC2 overexpression lysate

NFATC2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn