TA343702 RLF antibody

Rabbit Polyclonal Anti-RLF Antibody

See related secondary antibodies

Search for all "RLF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine RLF

Product Description for RLF

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine RLF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RLF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rearranged L-myc fusion gene protein, Zinc finger protein Rlf, Zn-15-related protein
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13129
Immunogen:
The immunogen for anti-RLF antibody: synthetic peptide directed towards the N terminal of human RLF. Synthetic peptide located within the following region: AVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETELREQEVSEVS.
GeneID:
6018
Application WB
Background RLF may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RLF (2 products)

Catalog No. Species Pres. Purity   Source  

RLF

RLF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RLF

RLF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn