TA343703 ZNF281 antibody

Rabbit Polyclonal Anti-ZNF281 Antibody

See related secondary antibodies

Search for all "ZNF281"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZNF281

Product Description for ZNF281

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZNF281.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF281

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GC-box-binding zinc finger protein 1, GZP1, ZBP-99, ZBP99, Zinc finger DNA-binding protein 99, Zinc finger protein 281
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2X9
Immunogen:
The immunogen for anti-ZNF281 antibody: synthetic peptide directed towards the middle region of human ZNF281. Synthetic peptide located within the following region: PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR.
GeneID:
23528
Application WB
Background ZNF281 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF281 may be involved in transcriptiol regulation. It represses the transcription of a number of genes including gastrin and ornithine decarboxylase. ZNF281 binds to the G-rich box in the enhancer region of these genes.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF281 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF281

ZNF281 Human Purified
  Abnova Taiwan Corp.

ZNF281

ZNF281 Human Purified
  Abnova Taiwan Corp.

ZNF281

ZNF281 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF281

ZNF281 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF281 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF281 overexpression lysate

ZNF281 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn