TA343707 SAP30BP antibody

Rabbit Polyclonal Anti-SAP30BP Antibody

See related secondary antibodies

Search for all "SAP30BP"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SAP30BP

Product Description for SAP30BP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SAP30BP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SAP30BP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HCNGP, HTRG, HTRP, SAP30-binding protein, Transcriptional regulator protein HCNGP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHR5
Immunogen:
The immunogen for anti-SAP30BP antibody: synthetic peptide directed towards the C terminal of human SAP30BP. Synthetic peptide located within the following region: IEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPT.
GeneID:
29115
Application WB
Background SAP30BP is a component of a histone deacetylase complex conserved among eukaryotic organisms. This complex is active in deacetylating core histone octamers, but ictive in deacetylating nucleosomal histones due to the ibility of the histone binding proteins RbAp46 and RbAp48 to gain access to nucleosomal histones.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SAP30BP (1 products)

Catalog No. Species Pres. Purity   Source  

SAP30BP

SAP30BP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SAP30BP (2 products)

Catalog No. Species Pres. Purity   Source  

HCNGP 293T Cell Transient Overexpression Lysate(Denatured)

HCNGP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SAP30BP Lysate

Western Blot: SAP30BP Lysate [NBL1-15686] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SAP30BP
  Novus Biologicals Inc.
  • LinkedIn