TA343711 RACGAP1 antibody

Rabbit Polyclonal Anti-Racgap1 Antibody

See related secondary antibodies

Search for all "RACGAP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RACGAP1

Product Description for RACGAP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RACGAP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RACGAP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1478, MGCRACGAP, Male germ cell RacGap, Rac GTPase-activating protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9WVM1
Immunogen:
The immunogen for Anti-Racgap1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Racgap1. Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF.
GeneID:
26934
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn