TA343712 UHRF1 antibody

Rabbit Polyclonal Anti-UHRF1 Antibody

See related secondary antibodies

Search for all "UHRF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish UHRF1

TA343712

More Views

  • TA343712

Product Description for UHRF1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish UHRF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UHRF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase UHRF1, ICBP90, Inverted CCAAT box-binding protein of 90 kDa, NP95, Nuclear zinc finger protein Np95, RING finger protein 106, RNF106, Ubiquitin-like PHD and RING finger domain-containing protein 1, Ubiquitin-like-containing PHD and RING finger domains protein 1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96T88
Immunogen:
The immunogen for anti-UHRF1 antibody: synthetic peptide directed towards the N terminal of human UHRF1. Synthetic peptide located within the following region: MGVFAVPPLSADTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFH.
GeneID:
29128
Application WB
Background This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific D sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UHRF1 (3 products)

Catalog No. Species Pres. Purity   Source  

UHRF1 (transcript variant 2)

UHRF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UHRF1

UHRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UHRF1

UHRF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UHRF1 (2 products)

Catalog No. Species Pres. Purity   Source  

UHRF1 Lysate

Western Blot: UHRF1 Lysate [NBL1-17603] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UHRF1
  Novus Biologicals Inc.

UHRF1 overexpression lysate

UHRF1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn