TA343714 CNOT7 antibody

Rabbit Polyclonal Anti-CNOT7 Antibody

See related secondary antibodies

Search for all "CNOT7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish CNOT7

Product Description for CNOT7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish CNOT7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CNOT7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTG1-binding factor 1, CAF1, CCR4-NOT transcription complex subunit 7, CCR4-associated factor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UIV1
Immunogen:
The immunogen for anti-CNOT7 antibody: synthetic peptide directed towards the N terminal of human CNOT7. Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP.
GeneID:
29883
Application WB
Background CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes sigling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes sigling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alterte splicing of this gene results in two transcript variants encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CNOT7 (5 products)

Catalog No. Species Pres. Purity   Source  

CNOT7 (transcript variant 1)

CNOT7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CNOT7

CNOT7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CNOT7

CNOT7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CNOT7

CNOT7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CNOT7

CNOT7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CNOT7 (3 products)

Catalog No. Species Pres. Purity   Source  

CNOT7 Lysate

Western Blot: CNOT7 Lysate [NBL1-09320] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CNOT7
  Novus Biologicals Inc.

CNOT7 overexpression lysate

CNOT7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CNOT7 overexpression lysate

CNOT7 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn