TA343720 BTBD15 / ZBTB44 antibody

Rabbit Polyclonal Anti-Zbtb44 Antibody

See related secondary antibodies

Search for all "BTBD15 / ZBTB44"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BTBD15 / ZBTB44

Product Description for BTBD15 / ZBTB44

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BTBD15 / ZBTB44.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD15 / ZBTB44

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger and BTB domain-containing protein 44
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3SWU4
Immunogen:
The immunogen for Anti-Zbtb44 antibody is: synthetic peptide directed towards the N-terminal region of Rat Zbtb44. Synthetic peptide located within the following region: VKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAAC.
GeneID:
363035
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn