TA343738 ZNF232 antibody

Rabbit Polyclonal Anti-ZNF232 Antibody

See related secondary antibodies

Search for all "ZNF232"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF232

Product Description for ZNF232

Rabbit anti Human ZNF232.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF232

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZSCAN11, Zinc finger and SCAN domain-containing protein 11, Zinc finger protein 232
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UNY5
Immunogen:
The immunogen for anti-ZNF232 antibody: synthetic peptide directed towards the N terminal of human ZNF232. Synthetic peptide located within the following region: MEPPGPVRGPLQDSSWYEPSAELVQTRMAVSLTAAETLALQGTQGQEKMM.
GeneID:
7775
Application WB
Background ZNF232 is a new candidate transcription factor.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF232 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF232

ZNF232 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF232

ZNF232 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF232

ZNF232 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF232

ZNF232 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF232 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF232 293T Cell Transient Overexpression Lysate(Denatured)

ZNF232 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF232 Lysate

Western Blot: ZNF232 Lysate [NBL1-18094] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF232
  Novus Biologicals Inc.

ZNF232 overexpression lysate

ZNF232 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn