TA343740 OTX1 antibody

Rabbit Polyclonal Anti-OTX1 Antibody

See related secondary antibodies

Search for all "OTX1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish OTX1

Product Description for OTX1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish OTX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OTX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein OTX-1, Orthodenticle homolog 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P32242
Immunogen:
The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: HHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASW.
GeneID:
5013
Application WB
Background OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OTX1 (3 products)

Catalog No. Species Pres. Purity   Source  

OTX1

OTX1 Human
  Abnova Taiwan Corp.

OTX1

OTX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

OTX1

OTX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for OTX1 (2 products)

Catalog No. Species Pres. Purity   Source  

Otx1 Lysate

Western Blot: Otx1 Lysate [NBL1-14014] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for OTX1
  Novus Biologicals Inc.

OTX1 overexpression lysate

OTX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn