TA343744 CDR2L antibody

Rabbit Polyclonal Anti-CDR2L Antibody

See related secondary antibodies

Search for all "CDR2L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish CDR2L

Product Description for CDR2L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish CDR2L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CDR2L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cerebellar degeneration-related protein 2-like, HUMPPA, Paraneoplastic 62 kDa antigen
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86X02
Immunogen:
The immunogen for anti-CDR2L antibody: synthetic peptide directed towards the N terminal of human CDR2L. Synthetic peptide located within the following region: MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQ.
GeneID:
30850
Application WB
Background The function of CDR2L remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn