TA343754 ZFHX1B antibody

Rabbit Polyclonal Anti-ZEB2 Antibody

See related secondary antibodies

Search for all "ZFHX1B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish ZFHX1B

TA343754

More Views

  • TA343754
  • TA343754

Product Description for ZFHX1B

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish ZFHX1B.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZFHX1B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0569, SIP1, SMADIP1, Smad-interacting protein 1, ZEB2, ZFX1B, Zinc finger E-box-binding homeobox 2, Zinc finger homeobox protein 1b
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60315
Immunogen:
The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2. Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME.
GeneID:
9839
Application WB
IHC
Background The ZFHX1B gene is a member of the delta-EF1/Zfh1 family of 2-handed zinc finger/homeodomain proteins. ZFHX1B is strongly transcribed at an early stage in the developing peripheral and central nervous systems of both mice and humans, in all neurol regions of the brains of 25-week human fetuses and adult mice, and in numerous nonneural tissues. The SMADIP1 gene (also known as SIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-58 AB056507.1 1-58 59-553 AL118674.1 57-551 554-5558 AB056507.1 553-5557 5559-5583 AI858477.1 1-25 c
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn