TA343772 RCOR1 antibody

Rabbit Polyclonal Anti-RCOR1 Antibody

See related secondary antibodies

Search for all "RCOR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse RCOR1

Product Description for RCOR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse RCOR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RCOR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CoREST, KIAA0071, RCOR, REST corepressor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKL0
Immunogen:
The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS.
GeneID:
23186
Application WB
Background RCOR1 is a functiol corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functiol corepressor required for regulation of neural-specific gene expression.[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RCOR1 (2 products)

Catalog No. Species Pres. Purity   Source  

RCOR1

RCOR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RCOR1

RCOR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn