TA343785 SF3B3 / SAP130 antibody

Rabbit Polyclonal Anti-SF3B3 Antibody

See related secondary antibodies

Search for all "SF3B3 / SAP130"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SF3B3 / SAP130

Product Description for SF3B3 / SAP130

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SF3B3 / SAP130.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SF3B3 / SAP130

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0017, Pre-mRNA-splicing factor SF3b 130 kDa subunit, SAP 130, SAP-130, SF3b130, STAF130, Spliceosome-associated protein 130, Splicing factor 3B subunit 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15393
Immunogen:
The immunogen for anti-SF3B3 antibody: synthetic peptide directed towards the middle region of human SF3B3. Synthetic peptide located within the following region: EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT.
GeneID:
23450
Application WB
Background SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S R unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mR upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mR. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and D repair.This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S R unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mR upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mR. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and D repair. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SF3B3 / SAP130 (3 products)

Catalog No. Species Pres. Purity   Source  

SF3B3 / SAP130

SF3B3 / SAP130 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

SF3B3 / SAP130

SF3B3 / SAP130 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SF3B3 / SAP130

SF3B3 / SAP130 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SF3B3 / SAP130 (1 products)

Catalog No. Species Pres. Purity   Source  

SAP130 Lysate

Western Blot: SAP130 Lysate [NBL1-15877] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SF3B3
  Novus Biologicals Inc.
  • LinkedIn