TA343789 PRPF6 antibody

Rabbit Polyclonal Anti-PRPF6 Antibody

See related secondary antibodies

Search for all "PRPF6"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PRPF6

Product Description for PRPF6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PRPF6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRPF6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ANT-1, C20orf14, PRP6 homolog, Pre-mRNA-processing factor 6, TOM, U5 snRNP-associated 102 kDa protein, U5-102 kDa protein, chromosome 20 open reading frame 14
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94906
Immunogen:
The immunogen for anti-PRPF6 antibody: synthetic peptide directed towards the N terminal of human PRPF6. Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE.
GeneID:
24148
Application WB
Background PRPF6 appears to be involved in pre-mR splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptiol activation and splicing.The protein encoded by this gene appears to be involved in pre-mR splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptiol activation and splicing.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRPF6 (1 products)

Catalog No. Species Pres. Purity   Source  

PRPF6

PRPF6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for PRPF6 (3 products)

Catalog No. Species Pres. Purity   Source  

C20orf14 Lysate

Western Blot: C20orf14 Lysate [NBL1-14824] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PRPF6
  Novus Biologicals Inc.

PRPF6 293T Cell Transient Overexpression Lysate(Denatured)

PRPF6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PRPF6 overexpression lysate

PRPF6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn