TA343793 GTPBP9 / OLA1 antibody

Rabbit Polyclonal Anti-GTPBP9 Antibody

See related secondary antibodies

Search for all "GTPBP9 / OLA1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat GTPBP9 / OLA1

Product Description for GTPBP9 / OLA1

Rabbit anti Bovine, Human, Mouse, Rat GTPBP9 / OLA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GTPBP9 / OLA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTP-binding protein 9, Obg-like ATPase 1
Presentation Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NTK5
Immunogen:
The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYH.
GeneID:
29789
Application WB
Background GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTPBP9 / OLA1 (5 products)

Catalog No. Species Pres. Purity   Source  

GTPBP9 / OLA1 (transcript variant 1)

GTPBP9 / OLA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GTPBP9 / OLA1 (1-396, His-tag)

GTPBP9 / OLA1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

GTPBP9 / OLA1 (1-396, His-tag)

GTPBP9 / OLA1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

GTPBP9 / OLA1

GTPBP9 / OLA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GTPBP9 / OLA1

GTPBP9 / OLA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GTPBP9 / OLA1 (2 products)

Catalog No. Species Pres. Purity   Source  

GTPBP9 Lysate

Western Blot: GTPBP9 Lysate [NBL1-13922] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for OLA1
  Novus Biologicals Inc.

OLA1 overexpression lysate

OLA1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn