TA343796 EWSR1 antibody

Rabbit Polyclonal Anti-EWSR1 Antibody

See related secondary antibodies

Search for all "EWSR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EWSR1

Product Description for EWSR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EWSR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EWSR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EWS, EWS oncogene, EWSR-1, Ewing sarcoma breakpoint region 1 protein, RNA-binding protein EWS
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q01844
Immunogen:
The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the N terminal of human EWSR1. Synthetic peptide located within the following region: PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ.
GeneID:
2130
Application WB
Background EWSR1 is a putative R binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EWSR1 (5 products)

Catalog No. Species Pres. Purity   Source  

EWSR1 (transcript variant EWS)

EWSR1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EWSR1

EWSR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EWSR1

EWSR1 Human Purified
  Abnova Taiwan Corp.

EWSR1

EWSR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EWSR1

EWSR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for EWSR1 (4 products)

Catalog No. Species Pres. Purity   Source  

EWSR1 Lysate

Western Blot: EWSR1 Lysate [NBL1-10371] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for EWSR1
  Novus Biologicals Inc.

EWSR1 overexpression lysate

EWSR1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

EWSR1 overexpression lysate

EWSR1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

EWSR1 overexpression lysate

EWSR1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn