TA343798 NIPP-1 antibody

Rabbit Polyclonal Anti-PPP1R8 Antibody

See related secondary antibodies

Search for all "NIPP-1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NIPP-1

TA343798

More Views

  • TA343798

Product Description for NIPP-1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NIPP-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NIPP-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARD1, NIPP1, Nuclear inhibitor of protein phosphatase 1, PPP1R8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12972
Immunogen:
The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the N terminal of human PPP1R8. Synthetic peptide located within the following region: THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD.
GeneID:
5511
Application WB
Background This gene, through altertive splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave R. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to Rse E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of R.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NIPP-1 (7 products)

Catalog No. Species Pres. Purity   Source  

NIPP-1 (transcript variant 2)

NIPP-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NIPP-1 (transcript variant 1)

NIPP-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NIPP-1 (1-351, His-tag)

NIPP-1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

NIPP-1 (1-351, His-tag)

NIPP-1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

NIPP-1

NIPP-1 Human in vitro transl.
  Abnova Taiwan Corp.

NIPP-1

NIPP-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NIPP-1

NIPP-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NIPP-1 (4 products)

Catalog No. Species Pres. Purity   Source  

NIPP1 Lysate

Western Blot: NIPP1 Lysate [NBL1-14686] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPP1R8
  Novus Biologicals Inc.

NIPP1 Lysate

Western Blot: NIPP1 Lysate [NBL1-14687] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPP1R8
  Novus Biologicals Inc.

PPP1R8 overexpression lysate

PPP1R8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PPP1R8 overexpression lysate

PPP1R8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn