TA343814 APOBEC1 complementation factor antibody

Rabbit Polyclonal Anti-A1CF Antibody

See related secondary antibodies

Search for all "APOBEC1 complementation factor"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish APOBEC1 complementation factor

Product Description for APOBEC1 complementation factor

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish APOBEC1 complementation factor.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for APOBEC1 complementation factor

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A1CF, ACF, ASP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ94
Immunogen:
The immunogen for anti-A1CF antibody: synthetic peptide directed towards the N terminal of human A1CF. Synthetic peptide located within the following region: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA.
GeneID:
29974
Application WB
Background Mammalian apolipoprotein B mR undergoes site-specific C to U deamition, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identica
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for APOBEC1 complementation factor (2 products)

Catalog No. Species Pres. Purity   Source  

APOBEC1 complementation factor (transcript variant 2)

APOBEC1 complementation factor Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

APOBEC1 complementation factor (transcript variant 3)

APOBEC1 complementation factor Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for APOBEC1 complementation factor (1 products)

Catalog No. Species Pres. Purity   Source  

ACF 293T Cell Transient Overexpression Lysate(Denatured)

ACF 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn