TA343822 EXOSC7 antibody

Rabbit Polyclonal Anti-EXOSC7 Antibody

See related secondary antibodies

Search for all "EXOSC7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EXOSC7

TA343822

More Views

  • TA343822

Product Description for EXOSC7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EXOSC7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EXOSC7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Exosome complex exonuclease RRP42, Exosome component 7, KIAA0116, RRP42, Ribosomal RNA-processing protein 42, p8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15024
Immunogen:
The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC.
GeneID:
23016
Application WB
Background EXOSC7 belongs to the Rse PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-R to the mature 5.8S rR.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EXOSC7 (7 products)

Catalog No. Species Pres. Purity   Source  

EXOSC7 (transcript variant 1)

EXOSC7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EXOSC7 (1-291, His-tag)

EXOSC7 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

EXOSC7 (1-291, His-tag)

EXOSC7 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

EXOSC7

EXOSC7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EXOSC7

EXOSC7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EXOSC7

EXOSC7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

EXOSC7

EXOSC7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for EXOSC7 (2 products)

Catalog No. Species Pres. Purity   Source  

EXOSC7 293T Cell Transient Overexpression Lysate(Denatured)

EXOSC7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

EXOSC7 Lysate

Western Blot: Exosome component 7  Lysate [NBL1-10388] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for Exosome component 7
  Novus Biologicals Inc.
  • LinkedIn