TA343825 LARP5 antibody

Rabbit Polyclonal Anti-Larp4b Antibody

See related secondary antibodies

Search for all "LARP5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LARP5

Product Description for LARP5

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LARP5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LARP5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0217, LARP4B, LARP5, La ribonucleoprotein domain family member 4B, La ribonucleoprotein domain family member 5, La-related protein 4B, La-related protein 5
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6A0A2
Immunogen:
The immunogen for Anti-Larp4b antibody is: synthetic peptide directed towards the middle region of Mouse Larp4b. Synthetic peptide located within the following region: ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY.
GeneID:
217980
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn