TA343839 SF3B14 / SAP14 antibody

Rabbit Polyclonal Anti-SF3B14 Antibody

See related secondary antibodies

Search for all "SF3B14 / SAP14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3B14 / SAP14

Product Description for SF3B14 / SAP14

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3B14 / SAP14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SF3B14 / SAP14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-110, HSPC175, HT006, Pre-mRNA branch site protein p14, SAP 14, SAP-14, SF3B14a, Splicing factor 3B 14 kDa subunit
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y3B4
Immunogen:
The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the middle region of human SF3B14. Synthetic peptide located within the following region: HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK.
GeneID:
51639
Application WB
Background SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mR branch site.This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mR branch site.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SF3B14 / SAP14 (6 products)

Catalog No. Species Pres. Purity   Source  

SF3B14 / SAP14 (full length, N-term HIS tag)

SF3B14 / SAP14 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

SF3B14 / SAP14 (1-125, His-tag)

SF3B14 / SAP14 Human Purified > 95 % E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

SF3B14 / SAP14 (1-125, His-tag)

SF3B14 / SAP14 Human Purified > 95 % E. coli
50 µg / €320.00
  OriGene Technologies GmbH

SF3B14 / SAP14

SF3B14 / SAP14 Human in vitro transl.
  Abnova Taiwan Corp.

SF3B14 / SAP14

SF3B14 / SAP14 Human Purified
  Novus Biologicals Inc.

SF3B14 / SAP14

SF3B14 / SAP14 Human Purified
  Novus Biologicals Inc.

Positive controls for SF3B14 / SAP14 (2 products)

Catalog No. Species Pres. Purity   Source  

SF3B6 overexpression lysate

SF3B6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SF3B14 Lysate

Western Blot: SF3B14 Lysate [NBL1-15876] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for SF3B14.
  Novus Biologicals Inc.
  • LinkedIn