TA343846 17-beta-HSD11 / HSD17B11 antibody

Rabbit Polyclonal Anti-HSD17B11 Antibody

See related secondary antibodies

Search for all "17-beta-HSD11 / HSD17B11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat 17-beta-HSD11 / HSD17B11

TA343846

More Views

  • TA343846

Product Description for 17-beta-HSD11 / HSD17B11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat 17-beta-HSD11 / HSD17B11.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for 17-beta-HSD11 / HSD17B11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 17-beta-HSD XI, 17-beta-hydroxysteroid dehydrogenase 11, CTCL tumor antigen HD-CL-03, Cutaneous T-cell lymphoma-associated antigen HD-CL-03, DHRS8, Dehydrogenase/reductase SDR family member 8, Estradiol 17-beta-dehydrogenase 11, PAN1B, PSEC0029, Retinal short-chain dehydrogenase/reductase 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBQ5
Immunogen:
The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG.
GeneID:
51170
Application IHC
WB
Background Short-chain alcohol dehydrogeses, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for 17-beta-HSD11 / HSD17B11 (7 products)

Catalog No. Species Pres. Purity   Source  

17-beta-HSD11 / HSD17B11

17-beta-HSD11 / HSD17B11 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

17-beta-HSD11 / HSD17B11 (20-285, His-tag)

17-beta-HSD11 / HSD17B11 Human Purified > 95 % E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

17-beta-HSD11 / HSD17B11 (20-285, His-tag)

17-beta-HSD11 / HSD17B11 Human Purified > 95 % E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

17-beta-HSD11 / HSD17B11

17-beta-HSD11 / HSD17B11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta-HSD11 / HSD17B11

17-beta-HSD11 / HSD17B11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

17-beta-HSD11 / HSD17B11 (17-beta)

17-beta-HSD11 / HSD17B11 Human Purified
  Novus Biologicals Inc.

17-beta-HSD11 / HSD17B11 (17-beta)

17-beta-HSD11 / HSD17B11 Human Purified
  Novus Biologicals Inc.

Positive controls for 17-beta-HSD11 / HSD17B11 (2 products)

Catalog No. Species Pres. Purity   Source  

DHRS8 293T Cell Transient Overexpression Lysate(Denatured)

DHRS8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HSD17B11 overexpression lysate

HSD17B11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn