TA343867 RBM22 antibody

Rabbit Polyclonal Anti-RBM22 Antibody

See related secondary antibodies

Search for all "RBM22"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RBM22

TA343867

More Views

  • TA343867
  • TA343867

Product Description for RBM22

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RBM22.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RBM22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pre-mRNA-splicing factor RBM22, RNA-binding motif protein 22, ZC3H16, Zinc finger CCCH domain-containing protein 16
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NW64
Immunogen:
The immunogen for anti-RBM22 antibody: synthetic peptide directed towards the C terminal of human RBM22. Synthetic peptide located within the following region: KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF.
GeneID:
55696
Application WB
IHC
Background RBM22 may be involved in pre-mR splicing.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RBM22 (4 products)

Catalog No. Species Pres. Purity   Source  

RBM22 (full length, N-term HIS tag)

RBM22 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

RBM22

RBM22 Human
  Abnova Taiwan Corp.

RBM22

RBM22 Human in vitro transl.
  Abnova Taiwan Corp.

RBM22

RBM22 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RBM22 (2 products)

Catalog No. Species Pres. Purity   Source  

FLJ10290 293T Cell Transient Overexpression Lysate(Denatured)

FLJ10290 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RBM22 Lysate

Western Blot: RBM22 Lysate [NBL1-15200] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RBM22
  Novus Biologicals Inc.
  • LinkedIn