TA343872 MSTO1 antibody

Rabbit Polyclonal Anti-MSTO1 Antibody

See related secondary antibodies

Search for all "MSTO1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MSTO1

Product Description for MSTO1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MSTO1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MSTO1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LST005, Protein misato homolog 1, SLTP005
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUK6
Immunogen:
The immunogen for anti-MSTO1 antibody: synthetic peptide directed towards the N terminal of human MSTO1. Synthetic peptide located within the following region: YRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGK.
GeneID:
55154
Application WB
Background MSTO1 is involved in the regulation of mitochondrial distribution and morphology.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MSTO1 (2 products)

Catalog No. Species Pres. Purity   Source  

MSTO1

MSTO1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MSTO1

MSTO1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MSTO1 (2 products)

Catalog No. Species Pres. Purity   Source  

MSTO1 293T Cell Transient Overexpression Lysate(Denatured)

MSTO1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MSTO1 overexpression lysate

MSTO1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn