TA343877 LARP6 antibody

Rabbit Polyclonal Anti-LARP6 Antibody

See related secondary antibodies

Search for all "LARP6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat LARP6

Product Description for LARP6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat LARP6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LARP6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acheron, Achn, LARP6, La ribonucleoprotein domain family member 6, La-related protein 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRS8
Immunogen:
The immunogen for anti-LARP6 antibody: synthetic peptide directed towards the middle region of human LARP6. Synthetic peptide located within the following region: MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC.
GeneID:
55323
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LARP6 (4 products)

Catalog No. Species Pres. Purity   Source  

LARP6 (transcript variant 2)

LARP6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LARP6

LARP6 Human
  Abnova Taiwan Corp.

LARP6

LARP6 Human Purified
  Abnova Taiwan Corp.

LARP6

LARP6 Human Purified
  Abnova Taiwan Corp.

Positive controls for LARP6 (2 products)

Catalog No. Species Pres. Purity   Source  

LARP6 293T Cell Transient Overexpression Lysate(Denatured)

LARP6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LARP6 overexpression lysate

LARP6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn