TA343880 ADARB2 / ADAR3 antibody

Rabbit Polyclonal Anti-ADARB2 Antibody

See related secondary antibodies

Search for all "ADARB2 / ADAR3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog ADARB2 / ADAR3

Product Description for ADARB2 / ADAR3

Rabbit anti Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog ADARB2 / ADAR3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ADARB2 / ADAR3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Double-stranded RNA-specific editase B2, RED2, RNA-dependent adenosine deaminase 3, RNA-editing deaminase 2, RNA-editing enzyme 2, dsRNA adenosine deaminase B2
Presentation Aff - Purified
Reactivity African clawed frog, Can, Chk, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NS39
Immunogen:
Synthetic peptide directed towards the middle region of human ADARB2
AA Sequence:
SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
GeneID:
105
Application Western blotting (0.2 - 1.0 µg/ml)
Background ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
General Readings Andersen,J.S., (2005) Nature 433 (7021), 77-83
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Chicken, African clawed frog, Zebrafish
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Positive controls for ADARB2 / ADAR3 (1 products)

Catalog No. Species Pres. Purity   Source  

ADARB2 overexpression lysate

ADARB2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn