TA343894 DAZ3 antibody

Rabbit Polyclonal Anti-DAZ3 Antibody

See related secondary antibodies

Search for all "DAZ3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Rat DAZ3

Product Description for DAZ3

Rabbit anti Guinea Pig, Human, Rat DAZ3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DAZ3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Deleted in azoospermia protein 3
Presentation Purified
Reactivity GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NR90
Immunogen:
The immunogen for anti-DAZ3 antibody: synthetic peptide directed towards the middle region of human DAZ3. Synthetic peptide located within the following region: PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF.
GeneID:
57054
Application WB
Background This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an R-binding protein that is important
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DAZ3 (2 products)

Catalog No. Species Pres. Purity   Source  

DAZ3

DAZ3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DAZ3

DAZ3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn