TA343895 PCBP4 antibody

Rabbit Polyclonal Anti-PCBP4 Antibody

See related secondary antibodies

Search for all "PCBP4"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PCBP4

Product Description for PCBP4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PCBP4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCBP4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha-CP4, PCBP-4, Poly(rC)-binding protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P57723
Immunogen:
The immunogen for anti-PCBP4 antibody: synthetic peptide directed towards the middle region of human PCBP4. Synthetic peptide located within the following region: SVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP.
GeneID:
57060
Application WB
Background PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to R with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptiol activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to R with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptiol activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization sigls found in other subfamily members. Multiple altertively spliced transcript variants have been described, but the full-length ture for only some has been determined.This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to R with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptiol activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization sigls found in other subfamily members. Multiple altertively spliced transcript variants have been described, but the full-length ture for only some has been determined.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCBP4 (4 products)

Catalog No. Species Pres. Purity   Source  

PCBP4 (transcript variant 3)

PCBP4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PCBP4 (transcript variant 4)

PCBP4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PCBP4

PCBP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PCBP4

PCBP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PCBP4 (1 products)

Catalog No. Species Pres. Purity   Source  

MCG10 Lysate

Western Blot: MCG10 Lysate [NBL1-14145] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PCBP4
  Novus Biologicals Inc.
  • LinkedIn