TA343909 ELAVL4 / HUD antibody

Rabbit Polyclonal Anti-ELAVL4 Antibody

See related secondary antibodies

Search for all "ELAVL4 / HUD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ELAVL4 / HUD

Product Description for ELAVL4 / HUD

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ELAVL4 / HUD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ELAVL4 / HUD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ELAV-like protein 4, Hu-antigen D, PNEM, Paraneoplastic encephalomyelitis antigen HuD
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26378
Immunogen:
The immunogen for anti-ELAVL4 antibody: synthetic peptide directed towards the N terminal of human ELAVL4. Synthetic peptide located within the following region: MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG.
GeneID:
1996
Application WB
Background ELAVL4 may play a role in neuron-specific R processing. ELAVL4 protects CDKN1A mR from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRs, including VEGF and FOS mR.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ELAVL4 / HUD (3 products)

Catalog No. Species Pres. Purity   Source  

ELAVL4 / HUD (transcript variant 1)

ELAVL4 / HUD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ELAVL4 / HUD

ELAVL4 / HUD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ELAVL4 / HUD

ELAVL4 / HUD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ELAVL4 / HUD (5 products)

Catalog No. Species Pres. Purity   Source  

ELAVL4 293T Cell Transient Overexpression Lysate(Denatured)

ELAVL4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ELAVL4 overexpression lysate

ELAVL4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ELAVL4 overexpression lysate

ELAVL4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ELAVL4 overexpression lysate

ELAVL4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ELAVL4 overexpression lysate

ELAVL4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn