TA343917 MTHFSD antibody

Rabbit Polyclonal Anti-MTHFSD Antibody

See related secondary antibodies

Search for all "MTHFSD"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MTHFSD

TA343917

More Views

  • TA343917

Product Description for MTHFSD

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MTHFSD.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MTHFSD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ12998, FLJ13893, Methenyltetrahydrofolate synthetase domain-containing protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2M296
Immunogen:
The immunogen for anti-MTHFSD antibody: synthetic peptide directed towards the N terminal of human MTHFSD. Synthetic peptide located within the following region: EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL.
GeneID:
64779
Application WB
IHC
Background The function remains unknows.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MTHFSD (2 products)

Catalog No. Species Pres. Purity   Source  

MTHFSD (1-383, His-tag)

MTHFSD Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MTHFSD (1-383, His-tag)

MTHFSD Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH
  • LinkedIn