TA343929 RBM42 antibody

Rabbit Polyclonal Anti-RBM42 Antibody

See related secondary antibodies

Search for all "RBM42"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RBM42

Product Description for RBM42

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RBM42.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RBM42

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RNA-binding motif protein 42, RNA-binding protein 42
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTD8
Immunogen:
The immunogen for anti-RBM42 antibody: synthetic peptide directed towards the C terminal of human RBM42. Synthetic peptide located within the following region: DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR.
GeneID:
79171
Application WB
Background RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (R recognition motif) domain. The functions of RBM42 remain unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RBM42 (3 products)

Catalog No. Species Pres. Purity   Source  

RBM42

RBM42 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RBM42

RBM42 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RBM42

RBM42 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RBM42 (2 products)

Catalog No. Species Pres. Purity   Source  

RBM42 Lysate

Western Blot: RBM42 Lysate [NBL1-15212] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RBM42
  Novus Biologicals Inc.

RBM42 overexpression lysate

RBM42 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn