TA343942 hnRNP-A2/B1 / HNRNPA2B1 antibody

Rabbit Polyclonal Anti-HNRNPA2B1 Antibody

See related secondary antibodies

Search for all "hnRNP-A2/B1 / HNRNPA2B1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast hnRNP-A2/B1 / HNRNPA2B1

TA343942

More Views

  • TA343942

Product Description for hnRNP-A2/B1 / HNRNPA2B1

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast hnRNP-A2/B1 / HNRNPA2B1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for hnRNP-A2/B1 / HNRNPA2B1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HNRPA2B1, Heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 / hnRNP B1
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P22626
Immunogen:
The immunogen for anti-HNRNPA2B1 antibody: synthetic peptide directed towards the N terminal of human HNRNPA2B1. Synthetic peptide located within the following region: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC.
GeneID:
3181
Application WB
Background HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are R binding proteins and they complex with heterogeneous nuclear R (hnR). These proteins are associated with pre-mRs in the nucleus and appear to influence pre-mR processing and other aspects of mR metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRNPA2B1 has two repeats of quasi-RRM domains that bind to Rs.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are R binding proteins and they complex with heterogeneous nuclear R (hnR). These proteins are associated with pre-mRs in the nucleus and appear to influence pre-mR processing and other aspects of mR metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to Rs. This gene has been described to generate two altertively spliced transcript variants which encode different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for hnRNP-A2/B1 / HNRNPA2B1 (4 products)

Catalog No. Species Pres. Purity   Source  

hnRNP-A2/B1 / HNRNPA2B1 (transcript variant A2)

hnRNP-A2/B1 / HNRNPA2B1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

hnRNP-A2/B1 / HNRNPA2B1 (transcript variant B1)

hnRNP-A2/B1 / HNRNPA2B1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

hnRNP-A2/B1 / HNRNPA2B1

hnRNP-A2/B1 / HNRNPA2B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

hnRNP-A2/B1 / HNRNPA2B1

hnRNP-A2/B1 / HNRNPA2B1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn