TA343957 NXF5 antibody

Rabbit Polyclonal Anti-NXF5 Antibody

See related secondary antibodies

Search for all "NXF5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Rabbit NXF5

Product Description for NXF5

Rabbit anti Bovine, Canine, Human, Rabbit NXF5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NXF5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Nuclear RNA export factor 5, TAPL1
Presentation Purified
Reactivity Bov, Can, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1B4
Immunogen:
The immunogen for anti-NXF5 antibody: synthetic peptide directed towards the C terminal of human NXF5. Synthetic peptide located within the following region: FTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTA.
GeneID:
55998
Application WB
Background NXF5 is one member of a family of nuclear R export factors. Common domain features of this family are a noncanonical RNP-type R-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NXF5 (2 products)

Catalog No. Species Pres. Purity   Source  

NXF5

NXF5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NXF5

NXF5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NXF5 (1 products)

Catalog No. Species Pres. Purity   Source  

NXF5 overexpression lysate

NXF5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn