TA343960 ZCRB1 antibody

Rabbit Polyclonal Anti-ZCRB1 Antibody

See related secondary antibodies

Search for all "ZCRB1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast ZCRB1

Product Description for ZCRB1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast ZCRB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZCRB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger CCHC-type and RNA-binding motif-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBF4
Immunogen:
The immunogen for anti-ZCRB1 antibody: synthetic peptide directed towards the N terminal of human ZCRB1. Synthetic peptide located within the following region: MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS.
GeneID:
85437
Application WB
Background Pre-mR splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge conn
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZCRB1 (3 products)

Catalog No. Species Pres. Purity   Source  

ZCRB1

ZCRB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZCRB1

ZCRB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZCRB1

ZCRB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZCRB1 (2 products)

Catalog No. Species Pres. Purity   Source  

ZCRB1 293T Cell Transient Overexpression Lysate(Denatured)

ZCRB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZCRB1 Lysate

Western Blot: ZCRB1 Lysate [NBL1-17997] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZCRB1.
  Novus Biologicals Inc.
  • LinkedIn