TA343962 PURB antibody

Rabbit Polyclonal Anti-PURB Antibody

See related secondary antibodies

Search for all "PURB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat, Zebrafish PURB

Product Description for PURB

Rabbit anti Bovine, Human, Mouse, Rabbit, Rat, Zebrafish PURB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PURB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pur-beta, Purine-rich element-binding protein B, Transcriptional activator protein Pur-beta
Presentation Purified
Reactivity Bov, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96QR8
Immunogen:
The immunogen for anti-PURB antibody: synthetic peptide directed towards the N terminal of human PURB. Synthetic peptide located within the following region: MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV.
GeneID:
5814
Application WB
Background This gene product is a sequence-specific, single-stranded D-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of euka
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PURB (2 products)

Catalog No. Species Pres. Purity   Source  

PURB (1-312, His-tag)

PURB Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

PURB (1-312, His-tag)

PURB Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Positive controls for PURB (1 products)

Catalog No. Species Pres. Purity   Source  

PURB overexpression lysate

PURB overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn