TA343968 SFRS13A / FUSIP1 antibody

Rabbit Polyclonal Anti-FUSIP1 Antibody

See related secondary antibodies

Search for all "SFRS13A / FUSIP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SFRS13A / FUSIP1

TA343968

More Views

  • TA343968
  • TA343968

Product Description for SFRS13A / FUSIP1

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SFRS13A / FUSIP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SFRS13A / FUSIP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 40 kDa SR-repressor protein, FUS-interacting serine-arginine-rich protein 1, FUSIP2, SRrp40, Splicing factor SRp38, Splicing factor arginine/serine-rich 13A, TASR, TLS-associated SR protein, TLS-associated protein with Ser-Arg repeats, TLS-associated serine-arginine protein
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75494
Immunogen:
The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS.
GeneID:
10772
Application WB
IHC
Background FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated R splicing. Members of this family are characterized by N-termil RNP1 and RNP2 motifs, which are required for binding to R, and multiple C-termil SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mR. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mR splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated R splicing. Members of this family are characterized by N-termil RNP1 and RNP2 motifs, which are required for binding to R, and multiple C-termil SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mR. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mR splicing. Altertive splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing altertive polyA sites exist.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SFRS13A / FUSIP1 (3 products)

Catalog No. Species Pres. Purity   Source  

SFRS13A / FUSIP1 (transcript variant 1)

SFRS13A / FUSIP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SFRS13A / FUSIP1

SFRS13A / FUSIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SFRS13A / FUSIP1

SFRS13A / FUSIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SFRS13A / FUSIP1 (2 products)

Catalog No. Species Pres. Purity   Source  

FUSIP1 Lysate

Western Blot: FUSIP1 Lysate [NBL1-10862] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for SFRS13A.
  Novus Biologicals Inc.

SRSF10 overexpression lysate

SRSF10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn